RAB1A Peptide - middle region
RAB1A Peptide - middle region
Product Specifications
Product Name Alternative
Gtbp, Rab1, Ypt1, Rab-1, mKIAA3012
UniProt
P62821
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_033022.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
033281-ML405 100 µL
CCDC110, CT (CCDC110, KMHN1, Coiled-coil domain-containing protein 110, Cancer/testis antigen 52, Cancer/testis antigen KM-HN-1) (MaxLight 405) discontinued
Sign In for Pricing
View Details 
MBS1140157-01 0.02 mg (E-Coli)
Recombinant Human Protein CutA (CUTA)
Sign In for Pricing
View Details MBS1140157-02 0.1 mg (E-Coli)
Recombinant Human Protein CutA (CUTA)
Sign In for Pricing
View Details