Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB1A Peptide - middle region

RAB1A Peptide - middle region

Product Specifications

Product Name Alternative

Gtbp, Rab1, Ypt1, Rab-1, mKIAA3012

UniProt

P62821

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_033022.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSTA4 Peptide (AAP48555)
AAP48555-100UG 100 µg

GSTA4 Peptide (AAP48555)

Sign In for Pricing
View Details
Gefitinib analog III
T65550 50 mg

Gefitinib analog III

Sign In for Pricing
View Details
KDR Antibody
orb2308792-01 50 µL

KDR Antibody

Sign In for Pricing
View Details
KDR Antibody
orb2308792-02 100 µL

KDR Antibody

Sign In for Pricing
View Details
Phospho-PPP1R8/ARD1 (Ser199) Blocking Peptide
MBS9616416-01 1 mg

Phospho-PPP1R8/ARD1 (Ser199) Blocking Peptide

Sign In for Pricing
View Details
Phospho-PPP1R8/ARD1 (Ser199) Blocking Peptide
MBS9616416-02 5x 1 mg

Phospho-PPP1R8/ARD1 (Ser199) Blocking Peptide

Sign In for Pricing
View Details