Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IRF2 Peptide - middle region

IRF2 Peptide - middle region

Product Specifications

Product Name Alternative

IRF-2

UniProt

P14316

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002190.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NKPDLQVTIKEESNPVPYNSSWPPFQDLPLSSSMTPASSSSRPDRETRAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CACNA1F (Voltage-dependent L-type Calcium Channel Subunit alpha-1F, Voltage-gated Calcium Channel Subunit alpha Cav1.4, CACNAF1) (AP) discontinued
124205-AP 100 µL

CACNA1F (Voltage-dependent L-type Calcium Channel Subunit alpha-1F, Voltage-gated Calcium Channel Subunit alpha Cav1.4, CACNAF1) (AP) discontinued

Sign In for Pricing
View Details
60S ribosomal protein L19 (RPL19) Canine ELISA Kit
B1312 96 Tests

60S ribosomal protein L19 (RPL19) Canine ELISA Kit

Sign In for Pricing
View Details
Nogo B Polyclonal Antibody Bio Conjugated
orb1540978 100 µL

Nogo B Polyclonal Antibody Bio Conjugated

Sign In for Pricing
View Details
D8Ertd82e ORF Vector (Mouse) (pORF)
ORF042575 1.0 µg DNA

D8Ertd82e ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Ophn1 3'UTR Luciferase Stable Cell Line
TU115701 1.0 mL

Ophn1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
BAM-12P (7-12)
E-PP-0748-01 10 mg

BAM-12P (7-12)

Sign In for Pricing
View Details