Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2A Peptide - N-terminal region

UBE2A Peptide - N-terminal region

Product Specifications

Product Name Alternative

UBC2, HHR6A, MRXSN, RAD6A, MRXS30

UniProt

Q9Z255

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001269090.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DFKRLQEDPPAGVSGAPSENNIMVWNAVIFGPEGTPFEDGTFKLTIEFTE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trav7d-6 Mouse siRNA Oligo Duplex (Locus ID 320734)
SR402575 1 Kit

Trav7d-6 Mouse siRNA Oligo Duplex (Locus ID 320734)

Sign In for Pricing
View Details
Mouse Slc29a4 activation kit by CRISPRa
GA215110 1 Kit

Mouse Slc29a4 activation kit by CRISPRa

Sign In for Pricing
View Details
METTL10 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1294307 1.0 µg DNA

METTL10 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
RGS16 (phospho Tyr168) Polyclonal Antibody
E20-60397 100 µg

RGS16 (phospho Tyr168) Polyclonal Antibody

Sign In for Pricing
View Details
NUCB1 Polyclonal Antibody
orb617699-01 50 μL

NUCB1 Polyclonal Antibody

Sign In for Pricing
View Details
NUCB1 Polyclonal Antibody
orb617699-02 100 µL

NUCB1 Polyclonal Antibody

Sign In for Pricing
View Details