RPS6KB1 Peptide - middle region
RPS6KB1 Peptide - middle region
Product Specifications
Product Name Alternative
S6K1, 70kDa, p70s6k, AA959758, AI256796, AI314060, p70/85s6k, 2610318I15Rik, 4732464A07Rik
UniProt
Q8BSK8
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001107806.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7099324 Inquire
Recombinant Oenothera elata subsp. hookeri Photosystem II reaction center protein M (psbM), partial
Sign In for Pricing
View Details 
43505064 1.0 µg DNA
SERPINH1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
Sign In for Pricing
View Details