RPS6KB1 Peptide - middle region
RPS6KB1 Peptide - middle region
Product Specifications
Product Name Alternative
S6K1, 70kDa, p70s6k, AA959758, AI256796, AI314060, p70/85s6k, 2610318I15Rik, 4732464A07Rik
UniProt
Q8BSK8
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001107806.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K0520006 1.0 µg DNA
CST6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
Sign In for Pricing
View Details 
MBS9369358-01 48 Well
Porcine Guanine Nucleotide-Binding Protein Subunit Beta-4 (GNB4) ELISA Kit
Sign In for Pricing
View Details MBS9369358-02 96 Well
Porcine Guanine Nucleotide-Binding Protein Subunit Beta-4 (GNB4) ELISA Kit
Sign In for Pricing
View Details