Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRB3 Peptide - middle region

CRB3 Peptide - middle region

Product Specifications

Product Name Alternative

AU015179, AU041752, 5730439B18

UniProt

Q8QZT4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_808306.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NGGLSSGAIVAITVVFSILGVLLIAVGLFLLMRKLREKRQTEGTYRPSSE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gli2 3'UTR Lenti-reporter-Luc Vector
21599086 1.0 µg

Gli2 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
4933434I20Rik CRISPR/Cas9 KO Plasmid (m)
sc-426624 20 µg

4933434I20Rik CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
Ctla2a sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6104207 1.0 µg DNA

Ctla2a sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
TRIM65-set siRNA/shRNA/RNAi Lentivector (Human)
47835091 4x 500 ng

TRIM65-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Mouse Coch (NM_001198835) AAV Particle
MR230479A1V 250 µL

Mouse Coch (NM_001198835) AAV Particle

Sign In for Pricing
View Details
Recombinant Human HEY2
P2414-01 50 µg

Recombinant Human HEY2

Sign In for Pricing
View Details