Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2L3 Peptide - C-terminal region

UBE2L3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

UbcM4, Ubce7, C79827

UniProt

P68037

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_033482.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cardiac Troponin T Recombinant Rabbit Monoclonal Antibody [SC64-03]
ET1610-51 100 µL

Cardiac Troponin T Recombinant Rabbit Monoclonal Antibody [SC64-03]

Sign In for Pricing
View Details
Recombinant Rat TNF-α Protein (hIgG1 Fc Tag)
PDMR100107-01 20 µg

Recombinant Rat TNF-α Protein (hIgG1 Fc Tag)

Sign In for Pricing
View Details
Recombinant Rat TNF-α Protein (hIgG1 Fc Tag)
PDMR100107-02 100 µg

Recombinant Rat TNF-α Protein (hIgG1 Fc Tag)

Sign In for Pricing
View Details
Recombinant Rat TNF-α Protein (hIgG1 Fc Tag)
PDMR100107-03 500 µg

Recombinant Rat TNF-α Protein (hIgG1 Fc Tag)

Sign In for Pricing
View Details
Recombinant Rat TNF-α Protein (hIgG1 Fc Tag)
PDMR100107-04 1 mg

Recombinant Rat TNF-α Protein (hIgG1 Fc Tag)

Sign In for Pricing
View Details
FBXO21 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2B8]
TA504016AM 100 µL

FBXO21 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2B8]

Sign In for Pricing
View Details