Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2L3 Peptide - C-terminal region

UBE2L3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

UbcM4, Ubce7, C79827

UniProt

P68037

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_033482.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nandrolone-13C2 Benzoate
TRC-N315006-25MG 25 mg

Nandrolone-13C2 Benzoate

Sign In for Pricing
View Details
PP1C gamma (PPP1CC) Rabbit Polyclonal Antibody
TA367202 100 µL

PP1C gamma (PPP1CC) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZBTB10 (NM_001105539) Human Over-expression Lysate
LY426258 100 µg

ZBTB10 (NM_001105539) Human Over-expression Lysate

Sign In for Pricing
View Details
Cyanidol 3-Glucoside
TRC-C987770-5MG 5 mg

Cyanidol 3-Glucoside

Sign In for Pricing
View Details
GK5 Rabbit Polyclonal Antibody
TA370119 100 µL

GK5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rnf103 Mouse Gene Knockout Kit (CRISPR)
KN514886 1 Kit

Rnf103 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details