GFI1B Peptide - C-terminal region
GFI1B Peptide - C-terminal region
Product Specifications
Product Name Alternative
Gfi-1B
UniProt
O70237
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_032140.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QVCGKAFSQSSNLITHSRKHTGFKPFSCELCTKGFQRKVDLRRHRESQHN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RHF830CKP 960 Tests
Human I 309 Construction Kit w/Developing Reagents & Plates
Sign In for Pricing
View Details 
MBS281573-01 48 Tests
Mouse WD repeat-containing protein 90 (WDR90) ELISA Kit
Sign In for Pricing
View Details MBS281573-02 96 Tests
Mouse WD repeat-containing protein 90 (WDR90) ELISA Kit
Sign In for Pricing
View Details MBS281573-03 5x 96 Tests
Mouse WD repeat-containing protein 90 (WDR90) ELISA Kit
Sign In for Pricing
View Details MBS281573-04 10x 96 Tests
Mouse WD repeat-containing protein 90 (WDR90) ELISA Kit
Sign In for Pricing
View Details