What is the catalog number for IL1RAP Peptide - C-terminal region?

The catalog number for IL1RAP Peptide - C-terminal region is orb1997742.

What sizes are available for IL1RAP Peptide - C-terminal region?

IL1RAP Peptide - C-terminal region is available in the following size(s): 100 µg.

Is IL1RAP Peptide - C-terminal region in stock?

IL1RAP Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

IL1RAP Peptide - C-terminal region

Product Specifications

Product Name Alternative

AI255955, AV239853, IL-1RAcP, 6430709H04Rik

UniProt

Q61730

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001152790.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RAKTVLTVIKWKGEKSKYPQGRFWKQLQVAMPVKKSPRWSSNDKQGLSYS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MNH03209 2x 5.0 nmol

hsa-miR-6069 miRNA Antagomir

Sign In for Pricing

View Details

AAP56273-100UG 100 µg

MTMR12 Peptide - middle region (AAP56273)

Sign In for Pricing

View Details

BZ53574 1 Vial

PCMV-SLC16A2 (human) -3xFLAG-Neo

Sign In for Pricing

View Details

TRV-0010165-01 10 µg

Recombinant Rho GDP Dissociation Inhibitor Alpha (ARHGDIa)

Sign In for Pricing

View Details

TRV-0010165-02 50 µg

Recombinant Rho GDP Dissociation Inhibitor Alpha (ARHGDIa)

Sign In for Pricing

View Details

TRV-0010165-03 100 µg

Recombinant Rho GDP Dissociation Inhibitor Alpha (ARHGDIa)

Sign In for Pricing

View Details