Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL1RAP Peptide - C-terminal region

IL1RAP Peptide - C-terminal region

Product Specifications

Product Name Alternative

AI255955, AV239853, IL-1RAcP, 6430709H04Rik

UniProt

Q61730

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001152790.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RAKTVLTVIKWKGEKSKYPQGRFWKQLQVAMPVKKSPRWSSNDKQGLSYS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FKSG14 (CENPK) Human Over-expression Lysate
orb1350475 100 µg

FKSG14 (CENPK) Human Over-expression Lysate

Sign In for Pricing
View Details
ASAH2 Rabbit pAb, PerCP-Cy7 conjugated
orb2822925 100 µL

ASAH2 Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
ELISA Kit For mRNA decay activator protein ZFP36
E5400m 96 Tests

ELISA Kit For mRNA decay activator protein ZFP36

Sign In for Pricing
View Details
G-CSF Rabbit mAb, unconjugated, detector (PBS Only)
orb2706809 100 µg

G-CSF Rabbit mAb, unconjugated, detector (PBS Only)

Sign In for Pricing
View Details
Recombinant Human INHB protein (GST,His tag)
MBS2570819-01 0.02 mg

Recombinant Human INHB protein (GST,His tag)

Sign In for Pricing
View Details
Recombinant Human INHB protein (GST,His tag)
MBS2570819-02 0.1 mg

Recombinant Human INHB protein (GST,His tag)

Sign In for Pricing
View Details