Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTA3 Peptide - middle region

MTA3 Peptide - middle region

Product Specifications

Product Name Alternative

MKIAA1266, 1110002J22Rik

UniProt

Q924K8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001164525.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ISSSNGKAGTVNGAVGTQFQPQSALLGRACESCYATQSHQWYSWGPPNMQ

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-NFKBIZ Antibody Picoband® Fluoro550 Conjugated
A05312-1-Fluoro550 100 µg/Vial

Anti-NFKBIZ Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
CSN4 CRISPR/Cas9 KO Plasmid (h)
sc-412126 20 µg

CSN4 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
(6-Methoxy-1H-indazol-5-yl) boronic acid
OR1004742-01 1 g

(6-Methoxy-1H-indazol-5-yl) boronic acid

Sign In for Pricing
View Details
(6-Methoxy-1H-indazol-5-yl) boronic acid
OR1004742-02 5 g

(6-Methoxy-1H-indazol-5-yl) boronic acid

Sign In for Pricing
View Details
Anti-GST antibody mouse monoclonal
60-025 Inquire

Anti-GST antibody mouse monoclonal

Sign In for Pricing
View Details
AGAP1 Protein Vector (Human) (pPM-N-D-C-HA)
PV320376 500 ng

AGAP1 Protein Vector (Human) (pPM-N-D-C-HA)

Sign In for Pricing
View Details