MTA3 Peptide - middle region
MTA3 Peptide - middle region
Product Specifications
Product Name Alternative
MKIAA1266, 1110002J22Rik
UniProt
Q924K8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001164525.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ISSSNGKAGTVNGAVGTQFQPQSALLGRACESCYATQSHQWYSWGPPNMQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K7345204 1.0 µg DNA
Olr129 sgRNA CRISPR Lentivector (Rat) (Target 3)
Sign In for Pricing
View Details 
43081114 3x 1.0 µg
Scaf4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
Sign In for Pricing
View Details 
MBS9244676-02 5x 0.1 mL
Olfactory receptor 5M11 Polyclonal Antibody
Sign In for Pricing
View Details