Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCAP31 Peptide - C-terminal region

BCAP31 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CDM, DDCH, BAP31, 6C6-AG, DXS1357E

UniProt

P51572

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001132913.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DGKA (C-term) Rabbit Polyclonal Antibody
AP15096PU-N 400 µL

DGKA (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Polystyrene A COOH
HA16020003.100G 100 g

Polystyrene A COOH

Sign In for Pricing
View Details
BRCC36 (BRCC3) Mouse Monoclonal Antibody [Clone ID: AT3B1]
AM09089PU-S 50 µL

BRCC36 (BRCC3) Mouse Monoclonal Antibody [Clone ID: AT3B1]

Sign In for Pricing
View Details
Human CCBE1 activation kit by CRISPRa
GA115605 1 Kit

Human CCBE1 activation kit by CRISPRa

Sign In for Pricing
View Details
MMP9 (Matrix Metalloproteinase 9) (2C3), CF740 conjugate, 0.1mg/mL
BNC741764-500 1x 500 µL

MMP9 (Matrix Metalloproteinase 9) (2C3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
S100a4 Mouse Gene Knockout Kit (CRISPR)
KN315238 1 Kit

S100a4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details