Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AQP9 Peptide - middle region

AQP9 Peptide - middle region

Product Specifications

Product Name Alternative

SSC1, AQP-9, T17287, HsT17287

UniProt

O43315

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_066190.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PYLSLANAFADQVVATMILLIIVFAIFDSRNLGAPRGLEPIAIGLLIIVI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMPX Polyclonal Antibody
E-AB-61337-01 60 µL

SMPX Polyclonal Antibody

Sign In for Pricing
View Details
SMPX Polyclonal Antibody
E-AB-61337-02 120 µL

SMPX Polyclonal Antibody

Sign In for Pricing
View Details
SMPX Polyclonal Antibody
E-AB-61337-03 200 µL

SMPX Polyclonal Antibody

Sign In for Pricing
View Details
SARM (SARM1) (C-term) Rabbit Polyclonal Antibody
AP07256PU-N 50 µg

SARM (SARM1) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MyoD1 (Rhabdomyosarcoma Marker) (MYOD1/2075R), CF488A conjugate, 0.1mg/mL
BNC882075-500 1x 500 µL

MyoD1 (Rhabdomyosarcoma Marker) (MYOD1/2075R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Txndc11 Mouse Gene Knockout Kit (CRISPR)
KN518508 1 Kit

Txndc11 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details