Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AQP9 Peptide - middle region

AQP9 Peptide - middle region

Product Specifications

Product Name Alternative

SSC1, AQP-9, T17287, HsT17287

UniProt

O43315

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_066190.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PYLSLANAFADQVVATMILLIIVFAIFDSRNLGAPRGLEPIAIGLLIIVI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse CD62L/L-Selectin protein (His tag)
PDEM100307-01 20 µg

Recombinant Mouse CD62L/L-Selectin protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse CD62L/L-Selectin protein (His tag)
PDEM100307-02 100 µg

Recombinant Mouse CD62L/L-Selectin protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse CD62L/L-Selectin protein (His tag)
PDEM100307-03 500 µg

Recombinant Mouse CD62L/L-Selectin protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse CD62L/L-Selectin protein (His tag)
PDEM100307-04 1 mg

Recombinant Mouse CD62L/L-Selectin protein (His tag)

Sign In for Pricing
View Details
Recombinant BCL6 Monoclonal Antibody
AN301444L-01 50 µL

Recombinant BCL6 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant BCL6 Monoclonal Antibody
AN301444L-02 100 µL

Recombinant BCL6 Monoclonal Antibody

Sign In for Pricing
View Details