Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALPL Peptide - middle region

ALPL Peptide - middle region

Product Specifications

Product Name Alternative

HOPS, TNAP, APTNAP, TNSALP, AP-TNAP

UniProt

P05186

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000469.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AYQLMHNIRDIDVIMGGGRKYMYPKNKTDVEYESDEKARGTRLDGLDLVD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cat Interleukin 21 ELISA Kit
MBS098515 Inquire

Cat Interleukin 21 ELISA Kit

Sign In for Pricing
View Details
HS6ST1 (NM_004807) Human Untagged Clone
SC317658 10 µg

HS6ST1 (NM_004807) Human Untagged Clone

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Lactoperoxidase (LPO)
MBS2167415-01 0.1 mL

Biotin-Linked Monoclonal Antibody to Lactoperoxidase (LPO)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Lactoperoxidase (LPO)
MBS2167415-02 0.2 mL

Biotin-Linked Monoclonal Antibody to Lactoperoxidase (LPO)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Lactoperoxidase (LPO)
MBS2167415-03 0.5 mL

Biotin-Linked Monoclonal Antibody to Lactoperoxidase (LPO)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Lactoperoxidase (LPO)
MBS2167415-04 1 mL

Biotin-Linked Monoclonal Antibody to Lactoperoxidase (LPO)

Sign In for Pricing
View Details