Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD55 Peptide - middle region

CD55 Peptide - middle region

Product Specifications

Product Name Alternative

CR, TC, DAF, CROM, CHAPLE

UniProt

P08174

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000565.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVPPTVQKPTTVNVPTTEVS

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDY1 Blocking Peptide
MBS9620426-01 1 mg

CDY1 Blocking Peptide

Sign In for Pricing
View Details
CDY1 Blocking Peptide
MBS9620426-02 5x 1 mg

CDY1 Blocking Peptide

Sign In for Pricing
View Details
CCDC103 (NM_213607) Human Recombinant Protein
TP308345M 100 µg

CCDC103 (NM_213607) Human Recombinant Protein

Sign In for Pricing
View Details
Azide-PEG-azide (MW 2000)
MBS5770335 Inquire

Azide-PEG-azide (MW 2000)

Sign In for Pricing
View Details
Recombinant Human Vitelline membrane outer layer 1 homolog protein (C-6His)
CD00677-01 10 µg

Recombinant Human Vitelline membrane outer layer 1 homolog protein (C-6His)

Sign In for Pricing
View Details
Recombinant Human Vitelline membrane outer layer 1 homolog protein (C-6His)
CD00677-02 50 µg

Recombinant Human Vitelline membrane outer layer 1 homolog protein (C-6His)

Sign In for Pricing
View Details