Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD55 Peptide - middle region

CD55 Peptide - middle region

Product Specifications

Product Name Alternative

CR, TC, DAF, CROM, CHAPLE

UniProt

P08174

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000565.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVPPTVQKPTTVNVPTTEVS

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Integrin β 2 (ITGB2) ELISA kit
GTR10470100 96 Well

Goat Integrin β 2 (ITGB2) ELISA kit

Sign In for Pricing
View Details
Human DEP-1/CD148 Alexa Fluor 405 Antibody (Clone 143-41)
FAB1934V-100UG 100 µg

Human DEP-1/CD148 Alexa Fluor 405 Antibody (Clone 143-41)

Sign In for Pricing
View Details
Anti-Mouse CD1d Antibody (1B1), FITC
FMD12911 100 Tests

Anti-Mouse CD1d Antibody (1B1), FITC

Sign In for Pricing
View Details
H mgB1 Rabbit Polyclonal Antibody
E10G10952 100 µL

H mgB1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
UBA52 Antibody
orb1330740 100 µg

UBA52 Antibody

Sign In for Pricing
View Details
Mouse Nphp3 Pre-designed siRNA Set A
SI109516A 1 Each

Mouse Nphp3 Pre-designed siRNA Set A

Sign In for Pricing
View Details