Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAD17 Peptide - C-terminal region

RAD17 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CCYC, R24L, RAD24, HRAD17, RAD17SP

UniProt

O75943

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001265551.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LTDREHGMIDPDSGDEAQLNGGHSAEESLGEPTQATVPETWSLPLSQNSA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRTAP9-8-set siRNA/shRNA/RNAi Lentivector (Human)
26223091 4x 500 ng

KRTAP9-8-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
PCNA (Proliferating Cell Nuclear Antigen) discontinued
P3115-05A 1 mL

PCNA (Proliferating Cell Nuclear Antigen) discontinued

Sign In for Pricing
View Details
Vom1r14 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
50000116 3x 1.0 µg

Vom1r14 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Guinea Pig Podocin ELISA Kit
MBS2611470-01 48 Well

Guinea Pig Podocin ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Podocin ELISA Kit
MBS2611470-02 96 Well

Guinea Pig Podocin ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Podocin ELISA Kit
MBS2611470-03 5x 96 Well

Guinea Pig Podocin ELISA Kit

Sign In for Pricing
View Details