Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTA1 Peptide - middle region

MTA1 Peptide - middle region

Product Specifications

UniProt

Q13330

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001190187.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TPAKVAPVINNGSPTILGKRSYEQHNGVDGNMKKRLLMPSRGLANHGQAR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GTF2A2 Antibody
OAAN02363-200UL 200 µL

GTF2A2 Antibody

Sign In for Pricing
View Details
MID1 Polyclonal Antibody
MBS2539548-01 0.06 mL

MID1 Polyclonal Antibody

Sign In for Pricing
View Details
MID1 Polyclonal Antibody
MBS2539548-02 0.12 mL

MID1 Polyclonal Antibody

Sign In for Pricing
View Details
MID1 Polyclonal Antibody
MBS2539548-03 0.2 mL

MID1 Polyclonal Antibody

Sign In for Pricing
View Details
MID1 Polyclonal Antibody
MBS2539548-04 5x 0.2 mL

MID1 Polyclonal Antibody

Sign In for Pricing
View Details
P3h1 Rat siRNA Oligo Duplex (Locus ID 114200)
SR507528 1 Kit

P3h1 Rat siRNA Oligo Duplex (Locus ID 114200)

Sign In for Pricing
View Details