What is the catalog number for ITGB5 Peptide - middle region?

The catalog number for ITGB5 Peptide - middle region is orb1997727.

What sizes are available for ITGB5 Peptide - middle region?

ITGB5 Peptide - middle region is available in the following size(s): 100 µg.

Is ITGB5 Peptide - middle region in stock?

ITGB5 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

ITGB5 Peptide - middle region

Product Specifications

UniProt

P18084

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002204.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PDACSTKRDCVECLLLHSGKPDNQTCHSLCRDEVITWVDTIVKDDQEAVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBP2-90274MFV500 0.1 mL

Rabbit Monoclonal ENO3 Antibody (003) [mFluor Violet 500 SE]

Sign In for Pricing

View Details

SR510678 1 Kit

Cdc42ep4 Rat siRNA Oligo Duplex (Locus ID 303653)

Sign In for Pricing

View Details

GTR15310659 1 Vial

Lentiviral human CDS2 shRNA (UAS) - Lentiviral human CDS2 shRNA (UAS, RFP) (100)

Sign In for Pricing

View Details

K4455808 1.0 µg DNA

Ccnd2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing

View Details

GTR15246654 1 Vial

Lentiviral mouse Fbxo46 shRNA (UAS) - Lentiviral mouse Fbxo46 shRNA (UAS) (100)

Sign In for Pricing

View Details

orb575648 100 µL

ZNF197 Rabbit Polyclonal Antibody

Sign In for Pricing

View Details