What is the catalog number for ITGB5 Peptide - middle region?

The catalog number for ITGB5 Peptide - middle region is orb1997727.

What sizes are available for ITGB5 Peptide - middle region?

ITGB5 Peptide - middle region is available in the following size(s): 100 µg.

Is ITGB5 Peptide - middle region in stock?

ITGB5 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

ITGB5 Peptide - middle region

Product Specifications

UniProt

P18084

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002204.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PDACSTKRDCVECLLLHSGKPDNQTCHSLCRDEVITWVDTIVKDDQEAVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

31203094 4x 500 ng

Mybpc3-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing

View Details

NBP3-18467R 0.1 mL

Rabbit Polyclonal ARMT1 Antibody [DyLight 550]

Sign In for Pricing

View Details

orb2416979 100 µL

PLEKHA9 Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing

View Details

32822034 100 µg

Olfr1377 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing

View Details

TRV-0019213-01 10 µg

Eukaryotic Vascular Cell Adhesion Molecule 1 (VCAM1)

Sign In for Pricing

View Details

TRV-0019213-02 50 µg

Eukaryotic Vascular Cell Adhesion Molecule 1 (VCAM1)

Sign In for Pricing

View Details