Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRKACB Peptide - C-terminal region

PRKACB Peptide - C-terminal region

Product Specifications

Product Name Alternative

CbPKA, Pkacb

UniProt

P68181

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001157670.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEEIRVSITEKC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Benzaldehyde-Alpha-d1
TRC-B119741-10MG 10 mg

Benzaldehyde-Alpha-d1

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8) (B22.1), 0.2mg/mL
BNUB1266-500 1x 500 µL

Cytokeratin 8 (KRT8) (B22.1), 0.2mg/mL

Sign In for Pricing
View Details
CD47 (IAP/964 + B6H12.2), CF405S conjugate, 0.1mg/mL
BNC041029-500 1x 500 µL

CD47 (IAP/964 + B6H12.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Elongation factor 1-gamma Recombinant Rabbit Monoclonal Antibody [JE54-03]
ET7110-45 100 µL

Elongation factor 1-gamma Recombinant Rabbit Monoclonal Antibody [JE54-03]

Sign In for Pricing
View Details
Bcl-2 (BCL2/782 + BCL2/796), CF405S conjugate, 0.1mg/mL
BNC041023-500 1x 500 µL

Bcl-2 (BCL2/782 + BCL2/796), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ENT1 (SLC29A1) (C-term) Rabbit Polyclonal Antibody
AP11116PU-N 400 µL

ENT1 (SLC29A1) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details