Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRKACB Peptide - C-terminal region

PRKACB Peptide - C-terminal region

Product Specifications

Product Name Alternative

CbPKA, Pkacb

UniProt

P68181

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001157670.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEEIRVSITEKC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POM121 Polyclonal Antibody
E-AB-52790-01 20 µL

POM121 Polyclonal Antibody

Sign In for Pricing
View Details
POM121 Polyclonal Antibody
E-AB-52790-02 60 µL

POM121 Polyclonal Antibody

Sign In for Pricing
View Details
POM121 Polyclonal Antibody
E-AB-52790-03 120 µL

POM121 Polyclonal Antibody

Sign In for Pricing
View Details
POM121 Polyclonal Antibody
E-AB-52790-04 200 µL

POM121 Polyclonal Antibody

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3 + CA72/733), CF647 conjugate, 0.1mg/mL
BNC470734-500 1x 500 µL

TAG-72 / CA72.4 (B72.3 + CA72/733), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
14-3-3 Sigma / Stratifin (CPTC-SFN-2), CF488A conjugate, 0.1mg/mL
BNC882481-500 1x 500 µL

14-3-3 Sigma / Stratifin (CPTC-SFN-2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details