Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPA1L Peptide - middle region

HSPA1L Peptide - middle region

Product Specifications

Product Name Alternative

Msh5, Hsc70t

UniProt

P16627

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_038586.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLQDYFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCGF Rabbit Polyclonal Antibody (BF680)
orb2491395 100 µL

SCGF Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
HRIO2 kinase ligand-1
T82174-01 1 mg

HRIO2 kinase ligand-1

Sign In for Pricing
View Details
HRIO2 kinase ligand-1
T82174-02 5 mg

HRIO2 kinase ligand-1

Sign In for Pricing
View Details
HRIO2 kinase ligand-1
T82174-03 10 mg

HRIO2 kinase ligand-1

Sign In for Pricing
View Details
HRIO2 kinase ligand-1
T82174-04 25 mg

HRIO2 kinase ligand-1

Sign In for Pricing
View Details
HRIO2 kinase ligand-1
T82174-05 50 mg

HRIO2 kinase ligand-1

Sign In for Pricing
View Details