HSPA1L Peptide - middle region
HSPA1L Peptide - middle region
Product Specifications
Product Name Alternative
Msh5, Hsc70t
UniProt
P16627
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_038586.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LLQDYFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2602546-01 48 Well
Guinea pig Nicotinamide Adenine Dinucleotide Phosphate Oxidase 2 (NOX2) ELISA Kit
Sign In for Pricing
View Details MBS2602546-02 96 Well
Guinea pig Nicotinamide Adenine Dinucleotide Phosphate Oxidase 2 (NOX2) ELISA Kit
Sign In for Pricing
View Details MBS2602546-03 5x 96 Well
Guinea pig Nicotinamide Adenine Dinucleotide Phosphate Oxidase 2 (NOX2) ELISA Kit
Sign In for Pricing
View Details MBS2602546-04 10x 96 Well
Guinea pig Nicotinamide Adenine Dinucleotide Phosphate Oxidase 2 (NOX2) ELISA Kit
Sign In for Pricing
View Details