STK39 Peptide - middle region
STK39 Peptide - middle region
Product Specifications
Product Name Alternative
DCHT, Rnl5, SPAK, RF005, AW227544, AW556857
UniProt
Q9Z1W9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_058562.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LLTRTPDIAQRAKKVRRVPGSSGHLHKTEDGDWEWSDDEMDEKSEEGKAA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K1367006 1.0 µg DNA
MUC5AC sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
Sign In for Pricing
View Details 
GTR15253283 1 Vial
Lentiviral mouse Kcnn3 shRNA (UAS) - Lentiviral mouse Kcnn3 shRNA (UAS, RFP) (25)
Sign In for Pricing
View Details 
TRIM29-4774R 50 µg
Recombinant Rhesus Macaque TRIM29 Protein, His (Fc)-Avi-tagged
Sign In for Pricing
View Details