What is the catalog number for STK39 Peptide - middle region?

The catalog number for STK39 Peptide - middle region is orb1997713.

What sizes are available for STK39 Peptide - middle region?

STK39 Peptide - middle region is available in the following size(s): 100 µg.

Is STK39 Peptide - middle region in stock?

STK39 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

STK39 Peptide - middle region

Product Specifications

Product Name Alternative

DCHT, Rnl5, SPAK, RF005, AW227544, AW556857

UniProt

Q9Z1W9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_058562.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLTRTPDIAQRAKKVRRVPGSSGHLHKTEDGDWEWSDDEMDEKSEEGKAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CF805370 100 µg

COX2 (PTGS2) Mouse Monoclonal Antibody [Clone ID: OTI2E1]

Sign In for Pricing

View Details

orb1505563 500 µg

SQSTM1/p62 Antibody Blocking Peptide

Sign In for Pricing

View Details

484147 100 µL

KIAA0090 (ER Membrane Protein Complex Subunit 1)

Sign In for Pricing

View Details

orb1672399 0.1 mg

Parathyroid Membrane Lysate

Sign In for Pricing

View Details

ARP66654_P050-Biotin 100 µL

RAB43 Antibody - C-terminal region : Biotin (ARP66654_P050-Biotin)

Sign In for Pricing

View Details

OM642733 500 mL

Fetal Bovine Serum (FBS) Australia Heat Inactivated

Sign In for Pricing

View Details