Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP20 Peptide - middle region

MMP20 Peptide - middle region

Product Specifications

UniProt

P57748

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_038931.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LNFVRINSGEADIMISFETGDHGDSYPFDGPRGTLAHAFAPGEGLGGDTH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CXorf22, ID (Uncharacterized Protein CXorf22, CXorf22) (AP) discontinued
C8375-80-AP 200 µL

CXorf22, ID (Uncharacterized Protein CXorf22, CXorf22) (AP) discontinued

Sign In for Pricing
View Details
Rubella IgG/IgM Rapid Test Kit
VMD26 25 Tests

Rubella IgG/IgM Rapid Test Kit

Sign In for Pricing
View Details
CHD4 Monoclonal Antibody
MBS9400052-01 0.1 mL

CHD4 Monoclonal Antibody

Sign In for Pricing
View Details
CHD4 Monoclonal Antibody
MBS9400052-02 5x 0.1 mL

CHD4 Monoclonal Antibody

Sign In for Pricing
View Details
Tyw5 (NM_001170473) Rat Tagged ORF Clone
RR216331 10 µg

Tyw5 (NM_001170473) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Cat Bladder cancer-associated protein (BLCAP) ELISA Kit
MBS285503-01 48 Tests

Cat Bladder cancer-associated protein (BLCAP) ELISA Kit

Sign In for Pricing
View Details