What is the catalog number for MMP20 Peptide - middle region?

The catalog number for MMP20 Peptide - middle region is orb1997712.

What sizes are available for MMP20 Peptide - middle region?

MMP20 Peptide - middle region is available in the following size(s): 100 µg.

Is MMP20 Peptide - middle region in stock?

MMP20 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

MMP20 Peptide - middle region

Product Specifications

UniProt

P57748

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_038931.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LNFVRINSGEADIMISFETGDHGDSYPFDGPRGTLAHAFAPGEGLGGDTH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABP-S-07437 5 Plates

B. anthracis Spore antigen Matched Antibody Pair Set [ABP-S-07437]

Sign In for Pricing

View Details

121781 20 Pack (20 Label (s) x 1 Pack)

TS-152.40-514-P-BK-20 Die-cut & Printed Numbers & Letters

Sign In for Pricing

View Details

orb1298802-01 1 mg

CTK8A3536

Sign In for Pricing

View Details

orb1298802-02 5 mg

CTK8A3536

Sign In for Pricing

View Details

orb1298802-03 1 ml x 10 mM (in DMSO)

CTK8A3536

Sign In for Pricing

View Details

orb1298802-04 10 mg

CTK8A3536

Sign In for Pricing

View Details