Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF13 Peptide - middle region

FGF13 Peptide - middle region

Product Specifications

Product Name Alternative

Fhf2

UniProt

P70377

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001277344.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KNKLNVFSRVKLFGSKKRRRRRPEPQLKGIVTKLYSRQGYHLQLQADGTI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prr5l Mouse Gene Knockout Kit (CRISPR)
KN514003 1 Kit

Prr5l Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TNK1 (NM_003985) Human Over-expression Lysate
LC401305 20 µg

TNK1 (NM_003985) Human Over-expression Lysate

Sign In for Pricing
View Details
Chromogranin A (CHGA) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B8]
TA506096AM 100 µL

Chromogranin A (CHGA) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B8]

Sign In for Pricing
View Details
Alpha-Solamargine
TRC-S676518-10MG 10 mg

Alpha-Solamargine

Sign In for Pricing
View Details
VC 50bp DNA Ladder, 5 x 50µg
NL1422 5 x 50μg

VC 50bp DNA Ladder, 5 x 50µg

Sign In for Pricing
View Details
Ywhaz Rabbit Polyclonal Antibody
TA362964 100 µL

Ywhaz Rabbit Polyclonal Antibody

Sign In for Pricing
View Details