Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF13 Peptide - middle region

FGF13 Peptide - middle region

Product Specifications

Product Name Alternative

Fhf2

UniProt

P70377

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001277344.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KNKLNVFSRVKLFGSKKRRRRRPEPQLKGIVTKLYSRQGYHLQLQADGTI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Palmitoyl-2-oleoyl-sn-glycerol-3-phosphocholine
TRC-P161000-50MG 50 mg

1-Palmitoyl-2-oleoyl-sn-glycerol-3-phosphocholine

Sign In for Pricing
View Details
Trip12 Mouse Gene Knockout Kit (CRISPR)
KN518250 1 Kit

Trip12 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS629861 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
4930433I11Rik Mouse Gene Knockout Kit (CRISPR)
KN500364 1 Kit

4930433I11Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human Kappa Light Chain (Kap-56), CF740 conjugate, 0.1mg/mL
BNC740859-500 1x 500 µL

Human Kappa Light Chain (Kap-56), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
UTS2D (UTS2B) Rabbit Polyclonal Antibody
TA367358 100 µL

UTS2D (UTS2B) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details