What is the catalog number for HYAL1 Peptide - middle region?

The catalog number for HYAL1 Peptide - middle region is orb1997710.

What sizes are available for HYAL1 Peptide - middle region?

HYAL1 Peptide - middle region is available in the following size(s): 100 µg.

Is HYAL1 Peptide - middle region in stock?

HYAL1 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

HYAL1 Peptide - middle region

Product Specifications

Product Name Alternative

Hya1, Hyal-1

UniProt

Q91ZJ9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_032343.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ELGTYPYYTPTGEPVFGGLPQNASLVTHLAHTFQDIKAAMPEPDFSGLAV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

orb2856230 100 µL

TOP1MT Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing

View Details

GTR15370560 1 Vial

Lentiviral human N4BP1 sgRNA gene knockout kit - Lentiviral human N4BP1 sgRNA gene knockout kit (25)

Sign In for Pricing

View Details

orb2861198 100 µL

MCART6 Rabbit pAb, AP conjugated

Sign In for Pricing

View Details

NBP2-32217JF646 0.1 mL

Rabbit Polyclonal Transaldolase 1 Antibody [Janelia Fluor 646]

Sign In for Pricing

View Details

107120 1 1 mL

Glycerol Extra Pure

Sign In for Pricing

View Details

036672-ML750 100 µL

HNRPLL, NT (HNRPLL, SRRF, Heterogeneous nuclear ribonucleoprotein L-like, Stromal RNA-regulating factor) (MaxLight 750) discontinued

Sign In for Pricing

View Details