HYAL1 Peptide - middle region
HYAL1 Peptide - middle region
Product Specifications
Product Name Alternative
Hya1, Hyal-1
UniProt
Q91ZJ9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_032343.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ELGTYPYYTPTGEPVFGGLPQNASLVTHLAHTFQDIKAAMPEPDFSGLAV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RSPRY1-7834M 50 µg
Recombinant Mouse RSPRY1 Protein, His (Fc)-Avi-tagged
Sign In for Pricing
View Details QY-E10717 96 Tests
Rat DnaJ/HSP40 Homolog Subfamily C (Member 12 (DNAJC12) ELISA kit
Sign In for Pricing
View Details GTR15126166 1 Vial
Lentiviral human OTUD3 shRNA (UAS) - Lentiviral human OTUD3 shRNA (UAS, GFP) plasmid
Sign In for Pricing
View Details