Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXC4 Peptide - middle region

HOXC4 Peptide - middle region

Product Specifications

Product Name Alternative

Hox-3.5

UniProt

P09024

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_038581.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TAYTRQQVLELEKEFHYNRYLTRRRRIEIAHSLCLSERQIKIWFQNRRMK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DMPE-PEG-Multi-Arms (4 arm 8 arm)
MPL0720K Each

DMPE-PEG-Multi-Arms (4 arm 8 arm)

Sign In for Pricing
View Details
Recombinant Human HAUS4 Protein
E30P66404B 50 µg

Recombinant Human HAUS4 Protein

Sign In for Pricing
View Details
AlaRS (AARS) Human shRNA Lentiviral Particle (Locus ID 16)
TL315039V 500 µL Each

AlaRS (AARS) Human shRNA Lentiviral Particle (Locus ID 16)

Sign In for Pricing
View Details
TRAM2 Antibody, Biotin conjugated
CSB-PA624011LD01HU-01 50 µg

TRAM2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
TRAM2 Antibody, Biotin conjugated
CSB-PA624011LD01HU-02 100 µg

TRAM2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Gm10488 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
21703114 3x 1.0 µg

Gm10488 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details