What is the catalog number for HOXC4 Peptide - middle region?

The catalog number for HOXC4 Peptide - middle region is orb1997708.

What sizes are available for HOXC4 Peptide - middle region?

HOXC4 Peptide - middle region is available in the following size(s): 100 µg.

Is HOXC4 Peptide - middle region in stock?

HOXC4 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

HOXC4 Peptide - middle region

Product Specifications

Product Name Alternative

Hox-3.5

UniProt

P09024

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_038581.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TAYTRQQVLELEKEFHYNRYLTRRRRIEIAHSLCLSERQIKIWFQNRRMK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBP3-08335V 100 µL

Mouse Monoclonal CD8 beta Antibody (CBB/1595) [DyLight 405]

Sign In for Pricing

View Details

KN507257 1 Kit

Gpr65 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing

View Details

MBS7196657 Inquire

Rabbit anti-Enterobacteria phage P7 (Bacteriophage P7) PACA Polyclonal Antibody

Sign In for Pricing

View Details

NBP2-89723AF405 0.1 mL

Rabbit Monoclonal Renin Antibody (009) [Alexa Fluor 405]

Sign In for Pricing

View Details

MBS6353862-01 0.1 mL

TBC1D13, ID (TBC1D13, TBC1 domain family member 13) (MaxLight 750)

Sign In for Pricing

View Details

MBS6353862-02 5x 0.1 mL

TBC1D13, ID (TBC1D13, TBC1 domain family member 13) (MaxLight 750)

Sign In for Pricing

View Details