Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

H2-D1 Peptide - middle region

H2-D1 Peptide - middle region

Product Specifications

Product Name Alternative

H-2D, H2-D, H2-K1

UniProt

P01895

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PLGKEQKYTCHVEHEGLPEPLTLRWGKEEPPSSTKTNTVIIAVPVVLGAV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glycophorin A / CD235a (GYPA/280), CF568 conjugate, 0.1mg/mL
BNC680280-100 1x 100 µL

Glycophorin A / CD235a (GYPA/280), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CO2 Incubator Air Jacketed BCAJ-302
BCAJ-302 1 Unit

CO2 Incubator Air Jacketed BCAJ-302

Sign In for Pricing
View Details
CD8a Mouse Monoclonal Antibody (SK1), CF®575 Conjugate - Biotium Choice
P009-575-125 1x 125 µL

CD8a Mouse Monoclonal Antibody (SK1), CF®575 Conjugate - Biotium Choice

Sign In for Pricing
View Details
Insite Markers
EC-897 0.5 mL

Insite Markers

Sign In for Pricing
View Details
OCT-2 (POU2F2) (B-Cell Marker) (OCT2/2136), CF594 conjugate, 0.1mg/mL
BNC942136-500 1x 500 µL

OCT-2 (POU2F2) (B-Cell Marker) (OCT2/2136), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PceI, 500U
RE1308 500 U

PceI, 500U

Sign In for Pricing
View Details