Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

H2-D1 Peptide - middle region

H2-D1 Peptide - middle region

Product Specifications

Product Name Alternative

H-2D, H2-D, H2-K1

UniProt

P01895

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PLGKEQKYTCHVEHEGLPEPLTLRWGKEEPPSSTKTNTVIIAVPVVLGAV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCL1 (T-Cell Marker) (TCL1/2079), CF740 conjugate, 0.1mg/mL
BNC742079-500 1x 500 µL

TCL1 (T-Cell Marker) (TCL1/2079), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD64 Antibody[10.1]
E-AB-F1082G-01 20 Tests

PE/Cyanine5 Anti-Human CD64 Antibody[10.1]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD64 Antibody[10.1]
E-AB-F1082G-02 100 Tests

PE/Cyanine5 Anti-Human CD64 Antibody[10.1]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD64 Antibody[10.1]
E-AB-F1082G-03 2x 100 Tests

PE/Cyanine5 Anti-Human CD64 Antibody[10.1]

Sign In for Pricing
View Details
Sodium Perfluorohexanesulfonate
TRC-S080865-50MG 50 mg

Sodium Perfluorohexanesulfonate

Sign In for Pricing
View Details
ABT 263
TRC-A112500-5MG 5 mg

ABT 263

Sign In for Pricing
View Details