Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CUX1 Peptide - C-terminal region

CUX1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CDP, CUX, p75, CASP, CDP1, COY1, Clox, p100, p110, p200, CUTL1, GOLIM6, CDP/Cut, Cux/CDP, Nbla10317

UniProt

P39880

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CUX1 Rabbit Polyclonal Antibody (orb573710) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LQSLFGLPEAAGARDSRDNPLRKKKAANLNSIIHRLEKAASREEPIEWEF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Nitrobiphenyl-2',3',4',5',6'-d5
TRC-N495795-50MG 50 mg

2-Nitrobiphenyl-2',3',4',5',6'-d5

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD21 Antibody[HB5]
E-AB-F1377H-01 20 Tests

PE/Cyanine7 Anti-Human CD21 Antibody[HB5]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD21 Antibody[HB5]
E-AB-F1377H-02 100 Tests

PE/Cyanine7 Anti-Human CD21 Antibody[HB5]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD21 Antibody[HB5]
E-AB-F1377H-03 2x 100 Tests

PE/Cyanine7 Anti-Human CD21 Antibody[HB5]

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (rC3e/2479), CF740 conjugate, 0.1mg/mL
BNC743790-100 1x 100 µL

CD3e (T-Cell Marker) (rC3e/2479), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CSAD Human Gene Knockout Kit (CRISPR)
KN418908 1 Kit

CSAD Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details