Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CUX1 Peptide - C-terminal region

CUX1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CDP, CUX, p75, CASP, CDP1, COY1, Clox, p100, p110, p200, CUTL1, GOLIM6, CDP/Cut, Cux/CDP, Nbla10317

UniProt

P39880

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CUX1 Rabbit Polyclonal Antibody (orb573710) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LQSLFGLPEAAGARDSRDNPLRKKKAANLNSIIHRLEKAASREEPIEWEF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rcor1 Mouse Gene Knockout Kit (CRISPR)
KN514617 1 Kit

Rcor1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PTF1A Mouse Monoclonal Antibody [Clone ID: OTI3G1]
CF810944 100 µg

PTF1A Mouse Monoclonal Antibody [Clone ID: OTI3G1]

Sign In for Pricing
View Details
Miz1 (ZBTB17) (NM_003443) Human Recombinant Protein
TP316143L 1 mg

Miz1 (ZBTB17) (NM_003443) Human Recombinant Protein

Sign In for Pricing
View Details
Mix-n-StainTM Maxi CF®680 Antibody Labeling Kit, 1x1mg labeling
#92422 1 Kit

Mix-n-StainTM Maxi CF®680 Antibody Labeling Kit, 1x1mg labeling

Sign In for Pricing
View Details
B3GNT4 (Center) Rabbit Polyclonal Antibody
AP50328PU-N 400 µL

B3GNT4 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NHP2 Polyclonal Antibody
E-AB-18904-01 20 µL

NHP2 Polyclonal Antibody

Sign In for Pricing
View Details