HECTD3 Peptide - middle region
HECTD3 Peptide - middle region
Product Specifications
UniProt
Q5T447
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with HECTD3 Rabbit Polyclonal Antibody (orb578785) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_078878
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TDDNFMPKRVVVYGGEGDNLKKLSDVSIDETLIGDVCVLEDMTVHLPIIE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC681058-100 1x 100 µL
Human Papillomavirus 16 (HPV-16) (HPV16/1058), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
TRC-L330190-25MG 25 mg
Leucyl-Phenylalanyl-Isoleucyl-Glutamyl-Tryptophyl-Leucyl-Lysine xTFA Salt
Sign In for Pricing
View Details 