Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HECTD3 Peptide - middle region

HECTD3 Peptide - middle region

Product Specifications

UniProt

Q5T447

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HECTD3 Rabbit Polyclonal Antibody (orb578785) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_078878

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TDDNFMPKRVVVYGGEGDNLKKLSDVSIDETLIGDVCVLEDMTVHLPIIE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

p66 alpha (GATAD2A) Human Knockdown Lysate
LY300172 100 µg

p66 alpha (GATAD2A) Human Knockdown Lysate

Sign In for Pricing
View Details
Human NLRP2B activation kit by CRISPRa
GA117298 1 Kit

Human NLRP2B activation kit by CRISPRa

Sign In for Pricing
View Details
Human TMEM14B activation kit by CRISPRa
GA113136 1 Kit

Human TMEM14B activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Lymphoid tissue
CS708037 5x 5 µm

Tissue FFPE Sections, Lymphoid tissue

Sign In for Pricing
View Details
Progesterone Receptor Recombinant Rabbit Monoclonal Antibody [JF0549]
ET1702-24 100 µL

Progesterone Receptor Recombinant Rabbit Monoclonal Antibody [JF0549]

Sign In for Pricing
View Details
Reproterol Hydrochloride
TRC-R237270-100MG 100 mg

Reproterol Hydrochloride

Sign In for Pricing
View Details