FIG4 Peptide - C-terminal region
FIG4 Peptide - C-terminal region
Product Specifications
Product Name Alternative
YVS, BTOP, SAC3, ALS11, CMT4J, KIAA0274, dJ249I4.1
UniProt
Q92562
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FIG4 Rabbit Polyclonal Antibody (orb580065) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_055660
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PISAFSQDNIYEVQPPRVDRKSTEIFQAHIQASQGIMQPLGKEDSSMYRE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC942009-100 1x 100 µL
CD4, Mouse (T-Cell Marker) (GK1.5), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
GM-103-10 1 mL
Colloidal Gold Conjugated Monoclonal Antibody to Free+Bound Lambda Light Chain, 10nm
Sign In for Pricing
View Details 
BNUM2430-50 1x 50 µL
YBX1 / Y-box Binding Protein 1 / YB-1 (Tumor Biomarker) (YBX1/2430), 1mg/mL
Sign In for Pricing
View Details 
