Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SULT1A1 Peptide - middlel region

SULT1A1 Peptide - middlel region

Product Specifications

Product Name Alternative

PST, Stp, Stp1, ST1A1, ST1A4, mSTp1, AI266890

UniProt

P52840

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KVSYGSWYQHVKEWWELRRTHPVLYLFYEDMKENPKREIKKILEFLGRSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Win 18446
TRC-W498820-10MG 10 mg

Win 18446

Sign In for Pricing
View Details
FGFR2 (NM_000141) Human Recombinant Protein
TP710096 20 µg

FGFR2 (NM_000141) Human Recombinant Protein

Sign In for Pricing
View Details
3,4-Dihydro-4-hydroxy-1(2H)-pyridinecarboxylic Acid Ethyl Ester
TRC-D678955-5G 5 g

3,4-Dihydro-4-hydroxy-1(2H)-pyridinecarboxylic Acid Ethyl Ester

Sign In for Pricing
View Details
Colloidal Gold Conjugated Sophora japonica (Pagoda Tree) -SJA-, 1mL 20nm
GP-2901-20 1 mL

Colloidal Gold Conjugated Sophora japonica (Pagoda Tree) -SJA-, 1mL 20nm

Sign In for Pricing
View Details
FOXJ3 Antibody
KC-1400-01 50 μL

FOXJ3 Antibody

Sign In for Pricing
View Details
FOXJ3 Antibody
KC-1400-02 100 µL

FOXJ3 Antibody

Sign In for Pricing
View Details