Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SULT1A1 Peptide - middlel region

SULT1A1 Peptide - middlel region

Product Specifications

Product Name Alternative

PST, Stp, Stp1, ST1A1, ST1A4, mSTp1, AI266890

UniProt

P52840

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KVSYGSWYQHVKEWWELRRTHPVLYLFYEDMKENPKREIKKILEFLGRSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Protein Phosphatase 3, Regulatory Subunit 1 (PPP3R1) ELISA Kit
RDR-PPP3R1-Ra-01 96 Tests

Rat Protein Phosphatase 3, Regulatory Subunit 1 (PPP3R1) ELISA Kit

Sign In for Pricing
View Details
Rat Protein Phosphatase 3, Regulatory Subunit 1 (PPP3R1) ELISA Kit
RDR-PPP3R1-Ra-02 48 Tests

Rat Protein Phosphatase 3, Regulatory Subunit 1 (PPP3R1) ELISA Kit

Sign In for Pricing
View Details
Transglutaminase 2 (TGM2) Mouse Monoclonal Antibody [Clone ID: OTI4H5]
CF809245 100 µg

Transglutaminase 2 (TGM2) Mouse Monoclonal Antibody [Clone ID: OTI4H5]

Sign In for Pricing
View Details
SEZ6L2 Human Gene Knockout Kit (CRISPR)
KN420064 1 Kit

SEZ6L2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ZWINT Polyclonal Antibody
E-AB-14670-01 20 µL

ZWINT Polyclonal Antibody

Sign In for Pricing
View Details
ZWINT Polyclonal Antibody
E-AB-14670-02 60 µL

ZWINT Polyclonal Antibody

Sign In for Pricing
View Details