Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXB1 Peptide - middlel region

HOXB1 Peptide - middlel region

Product Specifications

Product Name Alternative

Hox-2.9

UniProt

Q01822

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_032292.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YLSRARRVEIAATLELNETQVKIWFQNRRMKQKKREREGGRMPAGPPGCP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PerCP/Cyanine5.5 Anti-Human CD172a/b Antibody[SE5A5]
AN00317J-01 20 Tests

PerCP/Cyanine5.5 Anti-Human CD172a/b Antibody[SE5A5]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD172a/b Antibody[SE5A5]
AN00317J-02 100 Tests

PerCP/Cyanine5.5 Anti-Human CD172a/b Antibody[SE5A5]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD172a/b Antibody[SE5A5]
AN00317J-03 2x 100 Tests

PerCP/Cyanine5.5 Anti-Human CD172a/b Antibody[SE5A5]

Sign In for Pricing
View Details
PSMC3IP Human Gene Knockout Kit (CRISPR)
KN401045 1 Kit

PSMC3IP Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2-Bromo-5-picoline-d3
TRC-B685572-5MG 5 mg

2-Bromo-5-picoline-d3

Sign In for Pricing
View Details
Biosafety Transport Box BTBT-105
BTBT-105 1 Unit

Biosafety Transport Box BTBT-105

Sign In for Pricing
View Details