Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXB1 Peptide - middlel region

HOXB1 Peptide - middlel region

Product Specifications

Product Name Alternative

Hox-2.9

UniProt

Q01822

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_032292.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YLSRARRVEIAATLELNETQVKIWFQNRRMKQKKREREGGRMPAGPPGCP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

B4galt2 (NM_017377) Mouse Over-expression Lysate
LY715821 100 µg

B4galt2 (NM_017377) Mouse Over-expression Lysate

Sign In for Pricing
View Details
MBD4 Rabbit Polyclonal Antibody
TA361260 100 µL

MBD4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
6,7-Dibromo-2-naphthalenecarbonitrile
TRC-D418725-250MG 250 mg

6,7-Dibromo-2-naphthalenecarbonitrile

Sign In for Pricing
View Details
MSH6 (DNA Mismatch Repair Protein) (MSH6/3085), CF640R conjugate, 0.1mg/mL
BNC403085-500 1x 500 µL

MSH6 (DNA Mismatch Repair Protein) (MSH6/3085), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Liver
CS803214 5x 5 µm

Tissue FFPE Sections, Liver

Sign In for Pricing
View Details
Recombinant Human CD274 Protein (His Tag)
PDMH100256-01 20 µg

Recombinant Human CD274 Protein (His Tag)

Sign In for Pricing
View Details