BAG1 Peptide - middlel region
BAG1 Peptide - middlel region
Product Specifications
Product Name Alternative
BAG-1, Rap46
UniProt
Q60739
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001165210.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VPLPFQKLIFKGKSLKEMETPLSALGMQNGCRVMLIGEKSNPEEEVELKK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
A05492-Dylight594 100 µg
Anti-SPTBN2 Antibody Picoband®, Dylight594 Conjugate
Sign In for Pricing
View Details 
GTR15091922 1 Vial
Lentiviral human PGLYRP4 shRNA (UAS) - Lentiviral human PGLYRP4 shRNA (UAS, iRFP) (25)
Sign In for Pricing
View Details 
MBS7063946 Inquire
Recombinant Shewanella baltica Probable ubiquinone biosynthesis protein UbiB (ubiB), partial
Sign In for Pricing
View Details RC217081L4 10 µg
CDC2L5 (CDK13) (NM_003718) Human Tagged Lenti ORF Clone
Sign In for Pricing
View Details 595-MSM2-P1 100ug
Anti-Cyclin D1 Antibody Clone CCND1/809, Unconjugated-100ug
Sign In for Pricing
View Details